BINF_tut

Project maintained by sarbal Hosted on GitHub Pages — Theme by mattgraham

Week 5: Biopython and assignment help

Adapted from https://biopython.org/docs/1.75/api/Bio.Entrez.html

Objectives

This week’s tutorial is on biopython. You will learn:

Setting up

Start a new notebook. Save the file as “yourname_week5.ipynb”. As before, copy the code into your notebook as chunks.

Biopython

Biopython is a set of freely available tools for biological computation written in Python by an international team of developers. It is a distributed collaborative effort to develop Python libraries and applications which address the needs of current and future work in bioinformatics. Quick install:

pip install biopython

Then import into your notebook (or console/terminal or script):

import Bio

There is a lot of functionality in biopython (too much to cover here) but revolve around sequences and sequence analysis. These include BLAST searches, downloading sequences from NCBI, Phylogenetics, Cluster analysis, Graphics, etc. The most useful function is accessing NCBI through their e-utils API. Some extra tutorials here: https://biopython-tutorial.readthedocs.io/en/latest/notebooks/00%20-%20Tutorial%20-%20Index.html# NOTE: these will be important for your assigmment…

Sequences

from Bio.Seq import Seq

my_seq = Seq("CATGTAGACTAG")

# print out some details about it
print("seq %s is %i bases long" % (my_seq, len(my_seq)))

Reading and writing Sequence Files

Use the SeqIO module for reading or writing sequences as SeqRecord objects.

from Bio import SeqIO
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord

record = SeqRecord(
    Seq("MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVF"),
    id="YP_025292.1",
    name="HokC",
    description="toxic membrane protein, small",
    annotations={"molecule_type":"protein"}) ###
)
print(record)
# As Genbank entry
Bio.SeqIO.write(record, "HokC.gbk", "gb")
# As FASTA file 
Bio.SeqIO.write(record, "HokC.fasta", "fasta")

Other formats here: